1、 Inhibitors, Agonists, Screening Librarieswww.MedChemEData SheetBIOLOGICAL ACTIVITY: FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin4 peptide derivative.In Vitro: Exendin4 is a pure GLP1 receptor agonist. Exendin4 peptide derivatives are structurally derived from Exendin4 and mayrelates to dual GLP
2、1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolicsyndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP1/glucagon receptoragonists show reduced activity on the GIP receptor to reduce the risk
3、of hypoglycemia1.References: 1. US20150315260 A1Product Name: FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPSCat. No.: HY-P1229Molecular Formula:N/AMolecular Weight: 3692.15Target: Glucagon ReceptorPathway: GPCR/G ProteinSolubility: DMSOCaution: Product has not been fully validated for medical applications. For research use only.Tel: 609-228-6898 Fax: 609-228-5909 E-mail: techMedChemEAddress: 1 Deer Park Dr, Suite Q, Monmouth Junction, NJ 08852, USAwww.MedChemE
